Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9338_iso_4
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 796aa    MW: 89102 Da    PI: 6.3263
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                         +WT +E+e +  a +q G++ +++I  +++  +   q++++++ +
  cra_locus_9338_iso_4_len_2552_ver_3 40 AWTHQEEESFFSALRQVGKN-FEKITCRVQ-SKNKDQVRHYYYRL 82
                                         6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129312.4583687IPR017884SANT domain
SMARTSM007176.0E-43785IPR001005SANT/Myb domain
CDDcd001675.56E-44083No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 796 aa     Download sequence    Send to blast
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010653608.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X2
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLA0A068V8020.0A0A068V802_COFCA; Uncharacterized protein
STRINGVIT_08s0040g01460.t010.0(Vitis vinifera)